Lineage for d1d3bh_ (1d3b H:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2396390Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 2396391Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 2396392Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (11 proteins)
    forms homo and heteroheptameric ring structures
    Pfam PF01423
  6. 2396562Protein B core SNRNP protein [50190] (2 species)
    3jb9 chains b and E are B subunits from fission yeast; not included because sids are not case sensitive
  7. 2396563Species Human (Homo sapiens) [TaxId:9606] [50191] (1 PDB entry)
  8. 2396567Domain d1d3bh_: 1d3b H: [24807]
    Other proteins in same PDB: d1d3ba_, d1d3bc_, d1d3be_, d1d3bg_, d1d3bi_, d1d3bk_
    CASP3
    protein/RNA complex; complexed with cit, gol

Details for d1d3bh_

PDB Entry: 1d3b (more details), 2 Å

PDB Description: crystal structure of the d3b subcomplex of the human core snrnp domain at 2.0a resolution
PDB Compounds: (H:) protein (small nuclear ribonucleoprotein associated protein b)

SCOPe Domain Sequences for d1d3bh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d3bh_ b.38.1.1 (H:) B core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]}
vgksskmlqhidyrmrcilqdgrifigtfkafdkhmnlilcdcdefrkikpknskqaere
ekrvlglvllrgenlvsmtvegpppk

SCOPe Domain Coordinates for d1d3bh_:

Click to download the PDB-style file with coordinates for d1d3bh_.
(The format of our PDB-style files is described here.)

Timeline for d1d3bh_: