Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) |
Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 proteins) |
Protein automated matches [231466] (5 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [232069] (10 PDB entries) |
Domain d3nvyj1: 3nvy J:2-92 [248059] Other proteins in same PDB: d3nvya2, d3nvyb1, d3nvyb2, d3nvyc1, d3nvyc2, d3nvyj2, d3nvyk1, d3nvyk2, d3nvyl1, d3nvyl2 automated match to d3etrl1 complexed with fad, fes, mos, mte, que |
PDB Entry: 3nvy (more details), 2 Å
SCOPe Domain Sequences for d3nvyj1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3nvyj1 d.15.4.2 (J:2-92) automated matches {Cow (Bos taurus) [TaxId: 9913]} tadelvffvngkkvveknadpettllaylrrklglrgtklgcgeggcgactvmlskydrl qdkiihfsanaclapictlhhvavttvegig
Timeline for d3nvyj1: