| Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
| Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies) core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids |
Superfamily d.41.1: CO dehydrogenase molybdoprotein N-domain-like [54665] (2 families) ![]() |
| Family d.41.1.0: automated matches [230464] (1 protein) not a true family |
| Protein automated matches [230465] (2 species) not a true protein |
| Species Cow (Bos taurus) [TaxId:9913] [232071] (9 PDB entries) |
| Domain d3nvyc1: 3nvy C:571-694 [248057] Other proteins in same PDB: d3nvya1, d3nvya2, d3nvyb1, d3nvyb2, d3nvyc2, d3nvyj1, d3nvyj2, d3nvyk1, d3nvyk2, d3nvyl2 automated match to d3nrzc1 complexed with fad, fes, mos, mte, que |
PDB Entry: 3nvy (more details), 2 Å
SCOPe Domain Sequences for d3nvyc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3nvyc1 d.41.1.0 (C:571-694) automated matches {Cow (Bos taurus) [TaxId: 9913]}
dtvgrplphlaaamqasgeavycddipryenelflrlvtstrahakiksidvseaqkvpg
fvcflsaddipgsnetglfndetvfakdtvtcvghiigavvadtpehaeraahvvkvtye
dlpa
Timeline for d3nvyc1: