Lineage for d3nvwl2 (3nvw L:695-1315)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2194009Fold d.133: Molybdenum cofactor-binding domain [56002] (1 superfamily)
    beta(2)-alpha-beta-alpha-beta; 2 layers: a/b; mixed sheet: order 1243: crossing loops
  4. 2194010Superfamily d.133.1: Molybdenum cofactor-binding domain [56003] (2 families) (S)
    duplication: consists of 4 structural repeats arranged in 2 lobes
    contains one left-hand beta-alpha-beta unit per lobe
    automatically mapped to Pfam PF02738
  5. 2194011Family d.133.1.1: Molybdenum cofactor-binding domain [56004] (7 protein domains)
  6. 2194096Protein automated matches [230468] (3 species)
    not a true protein
  7. 2194097Species Cow (Bos taurus) [TaxId:9913] [232097] (10 PDB entries)
  8. 2194099Domain d3nvwl2: 3nvw L:695-1315 [248052]
    Other proteins in same PDB: d3nvwa1, d3nvwa2, d3nvwb1, d3nvwb2, d3nvwc1, d3nvwj1, d3nvwj2, d3nvwk1, d3nvwk2, d3nvwl1
    automated match to d3nrzc2
    complexed with fad, fes, gun, mos, mte

Details for d3nvwl2

PDB Entry: 3nvw (more details), 1.6 Å

PDB Description: Crystal Structure of Bovine Xanthine Oxidase in Complex with Guanine
PDB Compounds: (L:) Xanthine dehydrogenase/oxidase

SCOPe Domain Sequences for d3nvwl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nvwl2 d.133.1.1 (L:695-1315) automated matches {Cow (Bos taurus) [TaxId: 9913]}
iitiedaiknnsfygselkiekgdlkkgfseadnvvsgelyiggqdhfylethctiaipk
geegemelfvstqnamktqsfvakmlgvpvnrilvrvkrmgggfggketrstlvsvaval
aayktghpvrcmldrnedmlitggrhpflarykvgfmktgtivalevdhysnagnsrdls
hsimeralfhmdncykipnirgtgrlcktnlssntafrgfggpqalfiaenwmsevavtc
glpaeevrwknmykegdlthfnqrlegfsvprcwdeclkssqyyarksevdkfnkencwk
krglciiptkfgisftvpflnqagalihvytdgsvlvshggtemgqglhtkmvqvaskal
kipiskiyisetstntvpnssptaasvstdiygqavyeacqtilkrlepfkkknpdgswe
dwvmaayqdrvslsttgfyrtpnlgysfetnsgnafhyftygvacseveidcltgdhknl
rtdivmdvgsslnpaidigqvegafvqglglftleelhyspegslhtrgpstykipafgs
iptefrvsllrdcpnkkaiyaskavgepplflgasvffaikdairaaraqhtnnntkelf
rldspatpekirnacvdkftt

SCOPe Domain Coordinates for d3nvwl2:

Click to download the PDB-style file with coordinates for d3nvwl2.
(The format of our PDB-style files is described here.)

Timeline for d3nvwl2: