SCOPe 2.05: Domain d3nvwk2: 3nvw K:415-528

Lineage for d3nvwk2 (3nvw K:415-528)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
   core: beta(3,4)-alpha(3); alpha+beta sandwich

4. Superfamily d.87.2: CO dehydrogenase flavoprotein C-terminal domain-like [55447] (2 families)
   automatically mapped to Pfam PF03450

5. Family d.87.2.0: automated matches [232089] (1 protein)
   not a true family

6. Protein automated matches [232090] (2 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [232091] (10 PDB entries)

8. Domain d3nvwk2: 3nvw K:415-528 [248050]
   Other proteins in same PDB: d3nvwa1, d3nvwa2, d3nvwb1, d3nvwc1, d3nvwc2, d3nvwj1, d3nvwj2, d3nvwk1, d3nvwl1, d3nvwl2
   automated match to d3nvvb2
   complexed with fad, fes, gun, mos, mte

Details for d3nvwk2

PDB Entry: 3nvw, 1.6 Å

PDB Description: Crystal Structure of Bovine Xanthine Oxidase in Complex with Guanine

PDB Compounds: (K:) Xanthine dehydrogenase/oxidase

SCOPe Domain Sequences for d3nvwk2:

Sequence; same for both SEQRES and ATOM records:

>d3nvwk2 d.87.2.0 (K:415-528) automated matches {Cow (Bos taurus) [TaxId: 9913]}
deffsafkqasrreddiakvtcgmrvlfqpgsmqvkelalcyggmadrtisalkttqkql
skfwnekllqdvcaglaeelslspdapggmiefrrtltlsfffkfyltvlkklg

Timeline for d3nvwk2:

• d3nvwk2 first appeared in SCOPe 2.04
  
• d3nvwk2 appears in SCOPe 2.06
  
• d3nvwk2 appears in the current release, SCOPe 2.08