Lineage for d1d3bd_ (1d3b D:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 58846Fold b.38: Sm motif of small nuclear ribonucleoproteins, SNRNP [50181] (1 superfamily)
  4. 58847Superfamily b.38.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50182] (1 family) (S)
  5. 58848Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (5 proteins)
  6. 58909Protein B core SNRNP protein [50190] (1 species)
  7. 58910Species Human (Homo sapiens) [TaxId:9606] [50191] (1 PDB entry)
  8. 58912Domain d1d3bd_: 1d3b D: [24805]
    Other proteins in same PDB: d1d3ba_, d1d3bc_, d1d3be_, d1d3bg_, d1d3bi_, d1d3bk_

Details for d1d3bd_

PDB Entry: 1d3b (more details), 2 Å

PDB Description: crystal structure of the d3b subcomplex of the human core snrnp domain at 2.0a resolution

SCOP Domain Sequences for d1d3bd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d3bd_ b.38.1.1 (D:) B core SNRNP protein {Human (Homo sapiens)}
tvgksskmlqhidyrmrcilqdgrifigtfkafdkhmnlilcdcdefrkikpknskqaer
eekrvlglvllrgenlvsmtvegppp

SCOP Domain Coordinates for d1d3bd_:

Click to download the PDB-style file with coordinates for d1d3bd_.
(The format of our PDB-style files is described here.)

Timeline for d1d3bd_: