Class b: All beta proteins [48724] (93 folds) |
Fold b.38: Sm motif of small nuclear ribonucleoproteins, SNRNP [50181] (1 superfamily) |
Superfamily b.38.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50182] (1 family) |
Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (4 proteins) |
Protein B core SNRNP protein [50190] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [50191] (1 PDB entry) |
Domain d1d3bd_: 1d3b D: [24805] Other proteins in same PDB: d1d3ba_, d1d3bc_, d1d3be_, d1d3bg_, d1d3bi_, d1d3bk_ |
PDB Entry: 1d3b (more details), 2 Å
SCOP Domain Sequences for d1d3bd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d3bd_ b.38.1.1 (D:) B core SNRNP protein {Human (Homo sapiens)} tvgksskmlqhidyrmrcilqdgrifigtfkafdkhmnlilcdcdefrkikpknskqaer eekrvlglvllrgenlvsmtvegppp
Timeline for d1d3bd_: