Lineage for d3nvwk1 (3nvw K:224-414)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2547890Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 2547891Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) (S)
  5. 2547987Family d.145.1.3: CO dehydrogenase flavoprotein N-terminal domain-like [56187] (6 protein domains)
    automatically mapped to Pfam PF00941
  6. 2548046Protein automated matches [232070] (2 species)
    not a true protein
  7. 2548047Species Cow (Bos taurus) [TaxId:9913] [232074] (11 PDB entries)
  8. 2548049Domain d3nvwk1: 3nvw K:224-414 [248049]
    Other proteins in same PDB: d3nvwa1, d3nvwa2, d3nvwb2, d3nvwc1, d3nvwc2, d3nvwj1, d3nvwj2, d3nvwk2, d3nvwl1, d3nvwl2
    automated match to d3nvvb1
    complexed with fad, fes, gun, mos, mte

Details for d3nvwk1

PDB Entry: 3nvw (more details), 1.6 Å

PDB Description: Crystal Structure of Bovine Xanthine Oxidase in Complex with Guanine
PDB Compounds: (K:) Xanthine dehydrogenase/oxidase

SCOPe Domain Sequences for d3nvwk1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nvwk1 d.145.1.3 (K:224-414) automated matches {Cow (Bos taurus) [TaxId: 9913]}
pkqlrfegervtwiqastlkelldlkaqhpeaklvvgnteigiemkfknqlfpmiicpaw
ipelnavehgpegisfgaacalssvektlleavaklptqktevfrgvleqlrwfagkqvk
svaslggniitaspisdlnpvfmasgtkltivsrgtrrtvpmdhtffpsyrktllgpeei
llsieipysre

SCOPe Domain Coordinates for d3nvwk1:

Click to download the PDB-style file with coordinates for d3nvwk1.
(The format of our PDB-style files is described here.)

Timeline for d3nvwk1: