Lineage for d3nvwb2 (3nvw B:415-528)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1660045Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
    core: beta(3,4)-alpha(3); alpha+beta sandwich
  4. 1660205Superfamily d.87.2: CO dehydrogenase flavoprotein C-terminal domain-like [55447] (2 families) (S)
    automatically mapped to Pfam PF03450
  5. 1660267Family d.87.2.0: automated matches [232089] (1 protein)
    not a true family
  6. 1660268Protein automated matches [232090] (2 species)
    not a true protein
  7. 1660269Species Cow (Bos taurus) [TaxId:9913] [232091] (10 PDB entries)
  8. 1660270Domain d3nvwb2: 3nvw B:415-528 [248044]
    Other proteins in same PDB: d3nvwa1, d3nvwa2, d3nvwb1, d3nvwc1, d3nvwc2, d3nvwj1, d3nvwj2, d3nvwk1, d3nvwl1, d3nvwl2
    automated match to d3nvvb2
    complexed with fad, fes, gun, mos, mte

Details for d3nvwb2

PDB Entry: 3nvw (more details), 1.6 Å

PDB Description: Crystal Structure of Bovine Xanthine Oxidase in Complex with Guanine
PDB Compounds: (B:) Xanthine dehydrogenase/oxidase

SCOPe Domain Sequences for d3nvwb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nvwb2 d.87.2.0 (B:415-528) automated matches {Cow (Bos taurus) [TaxId: 9913]}
deffsafkqasrreddiakvtcgmrvlfqpgsmqvkelalcyggmadrtisalkttqkql
skfwnekllqdvcaglaeelslspdapggmiefrrtltlsfffkfyltvlkklg

SCOPe Domain Coordinates for d3nvwb2:

Click to download the PDB-style file with coordinates for d3nvwb2.
(The format of our PDB-style files is described here.)

Timeline for d3nvwb2: