SCOPe 2.08: Domain d3nvic_: 3nvi C:

Lineage for d3nvic_ (3nvi C:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.183: Nop domain [89123] (1 superfamily)
   multihelical; array of longer and shorter helices; contains an alpha-hairpin dimerisation subdomain

4. Superfamily a.183.1: Nop domain [89124] (2 families)

5. Family a.183.1.0: automated matches [254308] (1 protein)
   not a true family

6. Protein automated matches [254709] (2 species)
   not a true protein

7. Species Pyrococcus furiosus [TaxId:186497] [255986] (1 PDB entry)

8. Domain d3nvic_: 3nvi C: [248040]
   automated match to d2ozbb1
   protein/RNA complex

Details for d3nvic_

PDB Entry: 3nvi, 2.71 Å

PDB Description: Structure of N-terminal truncated Nop56/58 bound with L7Ae and box C/D RNA

PDB Compounds: (C:) NOP5/NOP56 related protein

SCOPe Domain Sequences for d3nvic_:

Sequence; same for both SEQRES and ATOM records:

>d3nvic_ a.183.1.0 (C:) automated matches {Pyrococcus furiosus [TaxId: 186497]}
qsgardkmviqaiealddvdkvinllvarlrewyslhfpeldellpkhpqyvafvktvgh
rdnineevlrelglseekikkileakektmgawmdqtdievvrqlaeeidrlyqlrkkle
dyidramddvapnlkalvgaklaarlislagglrelammpsstiqvlgaekalfrhlrtg
akppkhgviyqypainrspwwqrgkiaralagklaiaarvdyfsgeyiaeelkkeleari
reikeky

Timeline for d3nvic_:

• d3nvic_ first appeared in SCOPe 2.04
  
• d3nvic_ appears in SCOPe 2.07