![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.183: Nop domain [89123] (1 superfamily) multihelical; array of longer and shorter helices; contains an alpha-hairpin dimerisation subdomain |
![]() | Superfamily a.183.1: Nop domain [89124] (2 families) ![]() |
![]() | Family a.183.1.0: automated matches [254308] (1 protein) not a true family |
![]() | Protein automated matches [254709] (2 species) not a true protein |
![]() | Species Pyrococcus furiosus [TaxId:186497] [255986] (1 PDB entry) |
![]() | Domain d3nvic_: 3nvi C: [248040] automated match to d2ozbb1 protein/RNA complex |
PDB Entry: 3nvi (more details), 2.71 Å
SCOPe Domain Sequences for d3nvic_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3nvic_ a.183.1.0 (C:) automated matches {Pyrococcus furiosus [TaxId: 186497]} qsgardkmviqaiealddvdkvinllvarlrewyslhfpeldellpkhpqyvafvktvgh rdnineevlrelglseekikkileakektmgawmdqtdievvrqlaeeidrlyqlrkkle dyidramddvapnlkalvgaklaarlislagglrelammpsstiqvlgaekalfrhlrtg akppkhgviyqypainrspwwqrgkiaralagklaiaarvdyfsgeyiaeelkkeleari reikeky
Timeline for d3nvic_: