Lineage for d1d3bb_ (1d3b B:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2057136Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 2057137Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 2057138Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (8 proteins)
    forms homo and heteroheptameric ring structures
  6. 2057308Protein B core SNRNP protein [50190] (1 species)
  7. 2057309Species Human (Homo sapiens) [TaxId:9606] [50191] (1 PDB entry)
  8. 2057310Domain d1d3bb_: 1d3b B: [24804]
    Other proteins in same PDB: d1d3ba_, d1d3bc_, d1d3be_, d1d3bg_, d1d3bi_, d1d3bk_
    CASP3
    protein/RNA complex; complexed with cit, gol

Details for d1d3bb_

PDB Entry: 1d3b (more details), 2 Å

PDB Description: crystal structure of the d3b subcomplex of the human core snrnp domain at 2.0a resolution
PDB Compounds: (B:) protein (small nuclear ribonucleoprotein associated protein b)

SCOPe Domain Sequences for d1d3bb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d3bb_ b.38.1.1 (B:) B core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]}
skmlqhidyrmrcilqdgrifigtfkafdkhmnlilcdcdefrkikpknskqaereekrv
lglvllrgenlvsmtvegppp

SCOPe Domain Coordinates for d1d3bb_:

Click to download the PDB-style file with coordinates for d1d3bb_.
(The format of our PDB-style files is described here.)

Timeline for d1d3bb_: