Class a: All alpha proteins [46456] (285 folds) |
Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
Superfamily a.104.1: Cytochrome P450 [48264] (2 families) |
Family a.104.1.0: automated matches [191509] (1 protein) not a true family |
Protein automated matches [190847] (40 species) not a true protein |
Species Novosphingobium aromaticivorans [TaxId:279238] [189372] (11 PDB entries) |
Domain d3nv6a_: 3nv6 A: [248038] automated match to d4dxya_ complexed with cam, hem, peg |
PDB Entry: 3nv6 (more details), 2.2 Å
SCOPe Domain Sequences for d3nv6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3nv6a_ a.104.1.0 (A:) automated matches {Novosphingobium aromaticivorans [TaxId: 279238]} akverpanvpedrvyeidmyalngiedgyheawkkvqhpgipdliwtpftgghwiatngd tvkevysdptrfsseviflpkeagekyqmvptkmdppehtpyrkaldkglnlakirkved kvrevasslidsfaargecdfaaeyaelfpvhvfmaladlpledipvlseyarqmtrpeg ntpeematdleagnngfyayvdpiirarvggdgddlitlmvnseingeriahdkaqglis llllggldtvvnflsffmihlarhpelvaelrsdplklmrgaeemfrrfpvvsearmvak dqeykgvflkrgdmillptalhglddaanpepwkldfsrrsishstfgggphrcagmhla rmevivtleewlkripefsfkegetpiyhsgivaavenvplvwp
Timeline for d3nv6a_: