Lineage for d3nv5a_ (3nv5 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (63 species)
    not a true protein
  7. 2005772Species Novosphingobium aromaticivorans [TaxId:279238] [189372] (11 PDB entries)
  8. 2005795Domain d3nv5a_: 3nv5 A: [248037]
    automated match to d4dxya_
    complexed with hem, peg

Details for d3nv5a_

PDB Entry: 3nv5 (more details), 2.41 Å

PDB Description: Crystal Structure of Cytochrome P450 CYP101D2
PDB Compounds: (A:) cytochrome p450

SCOPe Domain Sequences for d3nv5a_:

Sequence, based on SEQRES records: (download)

>d3nv5a_ a.104.1.0 (A:) automated matches {Novosphingobium aromaticivorans [TaxId: 279238]}
akverpanvpedrvyeidmyalngiedgyheawkkvqhpgipdliwtpftgghwiatngd
tvkevysdptrfsseviflpkeagekyqmvptkmdppehtpyrkaldkglnlakirkved
kvrevasslidsfaargecdfaaeyaelfpvhvfmaladlpledipvlseyarqmtrpeg
ntpeematdleagnngfyayvdpiirarvggdgddlitlmvnseingeriahdkaqglis
llllggldtvvnflsffmihlarhpelvaelrsdplklmrgaeemfrrfpvvsearmvak
dqeykgvflkrgdmillptalhglddaanpepwkldfsrrsishstfgggphrcagmhla
rmevivtleewlkripefsfkegetpiyhsgivaavenvplvwp

Sequence, based on observed residues (ATOM records): (download)

>d3nv5a_ a.104.1.0 (A:) automated matches {Novosphingobium aromaticivorans [TaxId: 279238]}
akverpanvpedrvyeidmyalngiedgyheawkkvqhpgipdliwtpftgghwiatngd
tvkevysdptrfsseviflpkeekyqmvptkmdppehtpyrkaldkglnlakirkvedkv
revasslidsfaargecdfaaeyaelfpvhvfmaladlpledipvlseyarqmtrpepee
matdleagnngfyayvdpiirarvggdgddlitlmvnseingeriahdkaqglisllllg
gldtvvnflsffmihlarhpelvaelrsdplklmrgaeemfrrfpvvsearmvakdqeyk
gvflkrgdmillptalhglddaanpepwkldfsrrsishstfgggphrcagmhlarmevi
vtleewlkripefsfkegetpiyhsgivaavenvplvwp

SCOPe Domain Coordinates for d3nv5a_:

Click to download the PDB-style file with coordinates for d3nv5a_.
(The format of our PDB-style files is described here.)

Timeline for d3nv5a_: