Lineage for d3nudb1 (3nud B:1-462)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2085156Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2086424Family c.1.10.8: Class-II DAHP synthetase [141840] (2 protein domains)
    Pfam PF01474
  6. 2086425Protein Probable DAHP synthetase AroG, phenylalanine-repressible [141841] (1 species)
  7. 2086426Species Mycobacterium tuberculosis [TaxId:1773] [141842] (11 PDB entries)
    Uniprot O53512 1-462
  8. 2086438Domain d3nudb1: 3nud B:1-462 [248032]
    Other proteins in same PDB: d3nudb2
    automated match to d3nv8b_
    complexed with phe, po4

Details for d3nudb1

PDB Entry: 3nud (more details), 3 Å

PDB Description: The structure of 3-deoxy-d-arabino-heptulosonate 7-phosphate synthase from mycobacterium tuberculosis complexed with phenylalanine
PDB Compounds: (B:) Probable 3-deoxy-D-arabino-heptulosonate 7-phosphate synthase AroG

SCOPe Domain Sequences for d3nudb1:

Sequence, based on SEQRES records: (download)

>d3nudb1 c.1.10.8 (B:1-462) Probable DAHP synthetase AroG, phenylalanine-repressible {Mycobacterium tuberculosis [TaxId: 1773]}
mnwtvdipidqlpslpplptdlrtrldaalakpaaqqptwpadqalamrtvlesvppvtv
pseivrlqeqlaqvakgeafllqggdcaetfmdntephirgnvrallqmavvltygasmp
vvkvariagqyakprsadidalglrsyrgdmingfapdaaarehdpsrlvrayanasaam
nlvraltssglaslhlvhdwnrefvrtspagaryealateidrglrfmsacgvadrnlqt
aeiyashealvldyeramlrlsdgddgepqlfdlsahtvwigertrqidgahiafaqvia
npvgvklgpnmtpelaveyverldphnkpgrltlvsrmgnhkvrdllppivekvqatghq
viwqcdpmhgnthesstgfktrhfdrivdevqgffevhralgthpggihveitgenvtec
lggaqdisetdlagryetacdprlntqqslelaflvaemlrd

Sequence, based on observed residues (ATOM records): (download)

>d3nudb1 c.1.10.8 (B:1-462) Probable DAHP synthetase AroG, phenylalanine-repressible {Mycobacterium tuberculosis [TaxId: 1773]}
mnwtvdipipplptdlrtrldaalakpaaqqptwpadqalamrtvlesvppvtvpseivr
lqeqlaqvakgeafllqggdcaetfmdntephirgnvrallqmavvltygasmpvvkvar
iagqyakprsadidalglrsyrgdmingfapdaaarehdpsrlvrayanasaamnlvral
tssglaslhlvhdwnrefvrtspagaryealateidrglrfmsacgvadrnlqtaeiyas
healvldyeramlrlsdgddgepqlfdlsahtvwigertrqidgahiafaqvianpvgvk
lgpnmtpelaveyverldphnkpgrltlvsrmgnhkvrdllppivekvqatghqviwqcd
pmhgnthesfktrhfdrivdevqgffevhralgthpggihveitgenvtagryetacdpr
lntqqslelaflvaemlrd

SCOPe Domain Coordinates for d3nudb1:

Click to download the PDB-style file with coordinates for d3nudb1.
(The format of our PDB-style files is described here.)

Timeline for d3nudb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3nudb2
View in 3D
Domains from other chains:
(mouse over for more information)
d3nuda_