![]() | Class b: All beta proteins [48724] (93 folds) |
![]() | Fold b.38: Sm motif of small nuclear ribonucleoproteins, SNRNP [50181] (1 superfamily) |
![]() | Superfamily b.38.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50182] (1 family) ![]() |
![]() | Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (4 proteins) |
![]() | Protein D3 core SNRNP protein [50188] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [50189] (1 PDB entry) |
![]() | Domain d1d3bk_: 1d3b K: [24803] Other proteins in same PDB: d1d3bb_, d1d3bd_, d1d3bf_, d1d3bh_, d1d3bj_, d1d3bl_ |
PDB Entry: 1d3b (more details), 2 Å
SCOP Domain Sequences for d1d3bk_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d3bk_ b.38.1.1 (K:) D3 core SNRNP protein {Human (Homo sapiens)} vpikvlheaeghivtcetntgevyrgklieaednmncqmsnitvtyrdgrvaqleqvyir gckirflilpd
Timeline for d1d3bk_: