Lineage for d1d3bk_ (1d3b K:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 13541Fold b.38: Sm motif of small nuclear ribonucleoproteins, SNRNP [50181] (1 superfamily)
  4. 13542Superfamily b.38.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50182] (1 family) (S)
  5. 13543Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (4 proteins)
  6. 13558Protein D3 core SNRNP protein [50188] (1 species)
  7. 13559Species Human (Homo sapiens) [TaxId:9606] [50189] (1 PDB entry)
  8. 13565Domain d1d3bk_: 1d3b K: [24803]
    Other proteins in same PDB: d1d3bb_, d1d3bd_, d1d3bf_, d1d3bh_, d1d3bj_, d1d3bl_

Details for d1d3bk_

PDB Entry: 1d3b (more details), 2 Å

PDB Description: crystal structure of the d3b subcomplex of the human core snrnp domain at 2.0a resolution

SCOP Domain Sequences for d1d3bk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d3bk_ b.38.1.1 (K:) D3 core SNRNP protein {Human (Homo sapiens)}
vpikvlheaeghivtcetntgevyrgklieaednmncqmsnitvtyrdgrvaqleqvyir
gckirflilpd

SCOP Domain Coordinates for d1d3bk_:

Click to download the PDB-style file with coordinates for d1d3bk_.
(The format of our PDB-style files is described here.)

Timeline for d1d3bk_: