Lineage for d3ntja_ (3ntj A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2131690Family c.67.1.4: GABA-aminotransferase-like [53417] (17 protein domains)
    formerly omega-Aminoacid:pyruvate aminotransferase-like
  6. 2131998Protein automated matches [190152] (22 species)
    not a true protein
  7. 2132035Species Plasmodium falciparum [TaxId:36329] [255985] (1 PDB entry)
  8. 2132036Domain d3ntja_: 3ntj A: [248025]
    automated match to d3lg0a_
    complexed with so4

Details for d3ntja_

PDB Entry: 3ntj (more details), 3 Å

PDB Description: Redox regulation of Plasmodium falciparum ornithine delta-aminotransferase
PDB Compounds: (A:) ornithine aminotransferase

SCOPe Domain Sequences for d3ntja_:

Sequence, based on SEQRES records: (download)

>d3ntja_ c.67.1.4 (A:) automated matches {Plasmodium falciparum [TaxId: 36329]}
kssqdymnneltygahnydpipvvlkrgkgvfvydiedrryydflsayssvnqghchpdi
lnaminqakklticsraffsdslgvceryltnlfgydkvlmmntgaeasetayklcrkwg
yevkkipensakiivcnnnfsgrtlgcvsastdkkcknnfgpfvpnflkvpyddlealek
elqdpnvcafivepvqgeagvivpsdsyfpgvaslckkynvlfvadevqtglgrtgkllc
thhygvkpdvillgkalsgghypisailanddvmlvlkpgehgstyggnplaaaicveal
kvlineklcenadklgapflqnlkeqlkdskvvrevrgkgllcaiefkndlvnvwdiclk
fkenglitrsvhdktvrltpplcitkeqldecteiivktvkffddnl

Sequence, based on observed residues (ATOM records): (download)

>d3ntja_ c.67.1.4 (A:) automated matches {Plasmodium falciparum [TaxId: 36329]}
kssqdymnneltygahnydpipvvlkrgkgvfvydiedrryydflsayssvnqghchpdi
lnaminqakklticsraffsdslgvceryltnlfgydkvlmmntgaeasetayklcrkwg
yevkkipensakiivcnnpnflkvpyddlealekelqdpnvcafivepvqgeagvivpsd
syfpgvaslckkynvlfvadevqtglgrtgkllcthhygvkpdvillgkalsgghypisa
ilanddvmlvlkpgehgstyggnplaaaicvealkvlineklcenadklgapflqnlkeq
lkdskvvrevrgkgllcaiefkndlvnvwdiclkfkenglitrsvhdktvrltpplcitk
eqldecteiivktvkffddnl

SCOPe Domain Coordinates for d3ntja_:

Click to download the PDB-style file with coordinates for d3ntja_.
(The format of our PDB-style files is described here.)

Timeline for d3ntja_: