SCOPe 2.07: Domain d3nt0a2: 3nt0 A:171-335

Lineage for d3nt0a2 (3nt0 A:171-335)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins)

6. Protein multi-copper oxidase CueO [69194] (1 species)

7. Species Escherichia coli [TaxId:562] [69195] (38 PDB entries)

8. Domain d3nt0a2: 3nt0 A:171-335 [248023]
   Other proteins in same PDB: d3nt0a4
   automated match to d3od3a2
   complexed with act, cu1; mutant

Details for d3nt0a2

PDB Entry: 3nt0, 1.8 Å

PDB Description: c500s (t1d) mutant of cueo soaked in and bound to cu(i)

PDB Compounds: (A:) Blue copper oxidase cueO

SCOPe Domain Sequences for d3nt0a2:

Sequence; same for both SEQRES and ATOM records:

>d3nt0a2 b.6.1.3 (A:171-335) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]}
mlpkqwgiddvpvivqdkkfsadgqidyqldvmtaavgwfgdtlltngaiypqhaaprgw
lrlrllngcnarslnfatsdnrplyviasdggllpepvkvselpvlmgerfevlvevndn
kpfdlvtlpvsqmgmaiapfdkphpvmriqpiaisasgalpdtls

Timeline for d3nt0a2:

• d3nt0a2 first appeared in SCOPe 2.04
  
• d3nt0a2 appears in SCOPe 2.06
  
• d3nt0a2 appears in the current release, SCOPe 2.08