Lineage for d3nt0a2 (3nt0 A:171-335)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1527467Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 1527468Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 1528133Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins)
  6. 1528252Protein multi-copper oxidase CueO [69194] (1 species)
  7. 1528253Species Escherichia coli [TaxId:562] [69195] (29 PDB entries)
  8. 1528318Domain d3nt0a2: 3nt0 A:171-335 [248023]
    automated match to d3od3a2
    complexed with act, cu1; mutant

Details for d3nt0a2

PDB Entry: 3nt0 (more details), 1.8 Å

PDB Description: c500s (t1d) mutant of cueo soaked in and bound to cu(i)
PDB Compounds: (A:) Blue copper oxidase cueO

SCOPe Domain Sequences for d3nt0a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nt0a2 b.6.1.3 (A:171-335) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]}
mlpkqwgiddvpvivqdkkfsadgqidyqldvmtaavgwfgdtlltngaiypqhaaprgw
lrlrllngcnarslnfatsdnrplyviasdggllpepvkvselpvlmgerfevlvevndn
kpfdlvtlpvsqmgmaiapfdkphpvmriqpiaisasgalpdtls

SCOPe Domain Coordinates for d3nt0a2:

Click to download the PDB-style file with coordinates for d3nt0a2.
(The format of our PDB-style files is described here.)

Timeline for d3nt0a2: