Lineage for d3nsya2 (3nsy A:171-335)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1527467Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 1527468Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 1528133Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins)
  6. 1528252Protein multi-copper oxidase CueO [69194] (1 species)
  7. 1528253Species Escherichia coli [TaxId:562] [69195] (29 PDB entries)
  8. 1528327Domain d3nsya2: 3nsy A:171-335 [248020]
    automated match to d3od3a2
    complexed with c2o, cu; mutant

Details for d3nsya2

PDB Entry: 3nsy (more details), 2.1 Å

PDB Description: the multi-copper oxidase cueo with six met to ser mutations (m358s, m361s,m362s,m364s,m366s,m368s)
PDB Compounds: (A:) Blue copper oxidase cueO

SCOPe Domain Sequences for d3nsya2:

Sequence, based on SEQRES records: (download)

>d3nsya2 b.6.1.3 (A:171-335) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]}
mlpkqwgiddvpvivqdkkfsadgqidyqldvmtaavgwfgdtlltngaiypqhaaprgw
lrlrllngcnarslnfatsdnrplyviasdggllpepvkvselpvlmgerfevlvevndn
kpfdlvtlpvsqmgmaiapfdkphpvmriqpiaisasgalpdtls

Sequence, based on observed residues (ATOM records): (download)

>d3nsya2 b.6.1.3 (A:171-335) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]}
mlpkqwgiddvpvivqdkkfsadgqidyqldvmtaavgwfgdtlltngaiypqhaaprgw
lrlrllngcnarslnfatsdnrplyviasdggllpepvkvselpvlmgerfevlvevndn
kpfdlvtlpvsqmgmaiapfdkphpvmriqpiailpdtls

SCOPe Domain Coordinates for d3nsya2:

Click to download the PDB-style file with coordinates for d3nsya2.
(The format of our PDB-style files is described here.)

Timeline for d3nsya2: