![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
![]() | Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins) |
![]() | Protein multi-copper oxidase CueO, N- and middle domain [418908] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [419322] (38 PDB entries) |
![]() | Domain d3nsfa1: 3nsf A:29-170 [248016] Other proteins in same PDB: d3nsfa3, d3nsfa4 automated match to d1kv7a1 |
PDB Entry: 3nsf (more details), 2 Å
SCOPe Domain Sequences for d3nsfa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3nsfa1 b.6.1.3 (A:29-170) multi-copper oxidase CueO, N- and middle domain {Escherichia coli [TaxId: 562]} aerptlpipdllttdarnriqltigagqstfggktattwgyngnllgpavklqrgkavtv diynqlteettlhwhglevpgevdggpqgiippggkrsvtlnvdqpaatcwfhphqhgkt grqvamglaglvvieddeilkl
Timeline for d3nsfa1: