Lineage for d3nsfa1 (3nsf A:29-170)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2771244Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins)
  6. 2771427Protein multi-copper oxidase CueO, N- and middle domain [418908] (1 species)
  7. 2771428Species Escherichia coli [TaxId:562] [419322] (38 PDB entries)
  8. 2771495Domain d3nsfa1: 3nsf A:29-170 [248016]
    Other proteins in same PDB: d3nsfa3, d3nsfa4
    automated match to d1kv7a1

Details for d3nsfa1

PDB Entry: 3nsf (more details), 2 Å

PDB Description: apo form of the multicopper oxidase cueo
PDB Compounds: (A:) Blue copper oxidase cueO

SCOPe Domain Sequences for d3nsfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nsfa1 b.6.1.3 (A:29-170) multi-copper oxidase CueO, N- and middle domain {Escherichia coli [TaxId: 562]}
aerptlpipdllttdarnriqltigagqstfggktattwgyngnllgpavklqrgkavtv
diynqlteettlhwhglevpgevdggpqgiippggkrsvtlnvdqpaatcwfhphqhgkt
grqvamglaglvvieddeilkl

SCOPe Domain Coordinates for d3nsfa1:

Click to download the PDB-style file with coordinates for d3nsfa1.
(The format of our PDB-style files is described here.)

Timeline for d3nsfa1: