SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3nsfa1 (3nsf A:29-170)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2036241Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2036242Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2036937Family b.6.1.3: Multidomain cupredoxins [49550] (8 protein domains)
  6. 2037062Protein multi-copper oxidase CueO [69194] (1 species)
  7. 2037063Species Escherichia coli [TaxId:562] [69195] (33 PDB entries)
  8. 2037136Domain d3nsfa1: 3nsf A:29-170 [248016]
    Other proteins in same PDB: d3nsfa4
    automated match to d1kv7a1

Details for d3nsfa1

PDB Entry: 3nsf (more details), 2 Å

PDB Description: Apo form of the multicopper oxidase CueO
PDB Compounds: (A:) Blue copper oxidase cueO

SCOPe Domain Sequences for d3nsfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nsfa1 b.6.1.3 (A:29-170) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]}
aerptlpipdllttdarnriqltigagqstfggktattwgyngnllgpavklqrgkavtv
diynqlteettlhwhglevpgevdggpqgiippggkrsvtlnvdqpaatcwfhphqhgkt
grqvamglaglvvieddeilkl

SCOPe Domain Coordinates for d3nsfa1:

Click to download the PDB-style file with coordinates for d3nsfa1.
(The format of our PDB-style files is described here.)

Timeline for d3nsfa1: