SCOPe 2.08: Domain d3nsca3: 3nsc A:336-516

Lineage for d3nsca3 (3nsc A:336-516)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins)

6. Protein multi-copper oxidase CueO, C-terminal domain [418909] (1 species)

7. Species Escherichia coli [TaxId:562] [419323] (38 PDB entries)

8. Domain d3nsca3: 3nsc A:336-516 [248015]
   Other proteins in same PDB: d3nsca1, d3nsca2, d3nsca4
   automated match to d3od3a3
   complexed with act, cu, so4; mutant
   has additional insertions and/or extensions that are not grouped together

Details for d3nsca3

PDB Entry: 3nsc, 1.5 Å

PDB Description: c500s mutant of cueo bound to cu(ii)

PDB Compounds: (A:) Blue copper oxidase cueO

SCOPe Domain Sequences for d3nsca3:

Sequence, based on SEQRES records:

>d3nsca3 b.6.1.3 (A:336-516) multi-copper oxidase CueO, C-terminal domain {Escherichia coli [TaxId: 562]}
slpalpslegltvrklqlsmdpmldmmgmqmlmekygdqamagmdhsqmmghmghgnmnh
mnhggkfdfhhankingqafdmnkpmfaaakgqyerwvisgvgdmmlhpfhihgtqfril
sengkppaahragwkdtvkvegnvsevlvkfnhdapkehaymahshllehedtgmmlgft
v

Sequence, based on observed residues (ATOM records):

>d3nsca3 b.6.1.3 (A:336-516) multi-copper oxidase CueO, C-terminal domain {Escherichia coli [TaxId: 562]}
slpalpslegltvrklqlsmdpmldmmgmqmlmekygdqamagmdfhhankingqafdmn
kpmfaaakgqyerwvisgvgdmmlhpfhihgtqfrilsengkppaahragwkdtvkvegn
vsevlvkfnhdapkehaymahshllehedtgmmlgftv

Timeline for d3nsca3:

• d3nsca3 first appeared in SCOPe 2.04
  
• d3nsca3 appears in SCOPe 2.07