![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
![]() | Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins) |
![]() | Protein multi-copper oxidase CueO, C-terminal domain [418909] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [419323] (38 PDB entries) |
![]() | Domain d3nsca3: 3nsc A:336-516 [248015] Other proteins in same PDB: d3nsca1, d3nsca2, d3nsca4 automated match to d3od3a3 complexed with act, cu, so4; mutant has additional insertions and/or extensions that are not grouped together |
PDB Entry: 3nsc (more details), 1.5 Å
SCOPe Domain Sequences for d3nsca3:
Sequence, based on SEQRES records: (download)
>d3nsca3 b.6.1.3 (A:336-516) multi-copper oxidase CueO, C-terminal domain {Escherichia coli [TaxId: 562]} slpalpslegltvrklqlsmdpmldmmgmqmlmekygdqamagmdhsqmmghmghgnmnh mnhggkfdfhhankingqafdmnkpmfaaakgqyerwvisgvgdmmlhpfhihgtqfril sengkppaahragwkdtvkvegnvsevlvkfnhdapkehaymahshllehedtgmmlgft v
>d3nsca3 b.6.1.3 (A:336-516) multi-copper oxidase CueO, C-terminal domain {Escherichia coli [TaxId: 562]} slpalpslegltvrklqlsmdpmldmmgmqmlmekygdqamagmdfhhankingqafdmn kpmfaaakgqyerwvisgvgdmmlhpfhihgtqfrilsengkppaahragwkdtvkvegn vsevlvkfnhdapkehaymahshllehedtgmmlgftv
Timeline for d3nsca3: