Lineage for d3ns1k1 (3ns1 K:224-414)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1675721Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 1675722Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) (S)
  5. 1675806Family d.145.1.3: CO dehydrogenase flavoprotein N-terminal domain-like [56187] (6 proteins)
    automatically mapped to Pfam PF00941
  6. 1675867Protein automated matches [232070] (1 species)
    not a true protein
  7. 1675868Species Cow (Bos taurus) [TaxId:9913] [232074] (10 PDB entries)
  8. 1675890Domain d3ns1k1: 3ns1 K:224-414 [248009]
    Other proteins in same PDB: d3ns1a1, d3ns1a2, d3ns1b2, d3ns1c1, d3ns1c2, d3ns1j1, d3ns1j2, d3ns1k2, d3ns1l1, d3ns1l2
    automated match to d3eub31
    complexed with fad, fes, mos, mte, pm6

Details for d3ns1k1

PDB Entry: 3ns1 (more details), 2.6 Å

PDB Description: Crystal Structure of Bovine Xanthine Oxidase in Complex with 6-Mercaptopurine
PDB Compounds: (K:) Xanthine dehydrogenase/oxidase

SCOPe Domain Sequences for d3ns1k1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ns1k1 d.145.1.3 (K:224-414) automated matches {Cow (Bos taurus) [TaxId: 9913]}
pkqlrfegervtwiqastlkelldlkaqhpeaklvvgnteigiemkfknqlfpmiicpaw
ipelnavehgpegisfgaacalssvektlleavaklptqktevfrgvleqlrwfagkqvk
svaslggniitaspisdlnpvfmasgtkltivsrgtrrtvpmdhtffpsyrktllgpeei
llsieipysre

SCOPe Domain Coordinates for d3ns1k1:

Click to download the PDB-style file with coordinates for d3ns1k1.
(The format of our PDB-style files is described here.)

Timeline for d3ns1k1: