Lineage for d3nq5b_ (3nq5 B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2002034Fold a.86: Di-copper centre-containing domain [48055] (1 superfamily)
    multihelical
  4. 2002035Superfamily a.86.1: Di-copper centre-containing domain [48056] (4 families) (S)
    duplication: contains two structural repeats
  5. 2002102Family a.86.1.0: automated matches [254307] (1 protein)
    not a true family
  6. 2002103Protein automated matches [254708] (2 species)
    not a true protein
  7. 2002104Species Bacillus megaterium [TaxId:1404] [255981] (18 PDB entries)
  8. 2002128Domain d3nq5b_: 3nq5 B: [247999]
    automated match to d2ahka_
    complexed with cu, zn; mutant

Details for d3nq5b_

PDB Entry: 3nq5 (more details), 2.3 Å

PDB Description: Crystal Structure of Tyrosinase from Bacillus megaterium R209H mutant
PDB Compounds: (B:) tyrosinase

SCOPe Domain Sequences for d3nq5b_:

Sequence, based on SEQRES records: (download)

>d3nq5b_ a.86.1.0 (B:) automated matches {Bacillus megaterium [TaxId: 1404]}
kyrvrknvlhltdtekrdfvrtvlilkekgiydryiawhgaagkfhtppgsdrnaahmss
aflpwhreyllrferdlqsinpevtlpywewetdaqmqdpsqsqiwsadfmggngnpikd
fivdtgpfaagrwttideqgnpsgglkrnfgatkeaptlptrddvlnalkitqydtppwd
mtsqnsfrnqlegfingpqlhnrvhhwvggqmgvvptapndpvfflhhanvdriwavwqi
ihrnqnyqpmkngpfgqnfrdpmypwnttpedvmnhrklgyvydi

Sequence, based on observed residues (ATOM records): (download)

>d3nq5b_ a.86.1.0 (B:) automated matches {Bacillus megaterium [TaxId: 1404]}
kyrvrknvlhltdtekrdfvrtvlilkekgiydryiawhgaagkfhtppgsdrnaahmss
aflpwhreyllrferdlqsinpevtlpywewetdaqmqdpsqsqiwsadfmggngnpikd
fivdtgpfaagrwttideqgnpsgglkrnfgatkeaptlptrddvlnalkitqydtppwd
mtsqnsfrnqlegfingpqlhnrvhhwvggqmgvvptapndpvfflhhanvdriwavwqi
ihryqpmkngpfgqnfrdpmypwnttpedvmnhrklgyvydi

SCOPe Domain Coordinates for d3nq5b_:

Click to download the PDB-style file with coordinates for d3nq5b_.
(The format of our PDB-style files is described here.)

Timeline for d3nq5b_: