Lineage for d3nq5a_ (3nq5 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332526Fold a.86: Di-copper centre-containing domain [48055] (1 superfamily)
    multihelical
  4. 2332527Superfamily a.86.1: Di-copper centre-containing domain [48056] (4 families) (S)
    duplication: contains two structural repeats
  5. 2332594Family a.86.1.0: automated matches [254307] (1 protein)
    not a true family
  6. 2332595Protein automated matches [254708] (4 species)
    not a true protein
  7. 2332596Species Bacillus megaterium [TaxId:1404] [255981] (21 PDB entries)
  8. 2332625Domain d3nq5a_: 3nq5 A: [247998]
    automated match to d2ahka_
    complexed with cu, zn; mutant

Details for d3nq5a_

PDB Entry: 3nq5 (more details), 2.3 Å

PDB Description: Crystal Structure of Tyrosinase from Bacillus megaterium R209H mutant
PDB Compounds: (A:) tyrosinase

SCOPe Domain Sequences for d3nq5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nq5a_ a.86.1.0 (A:) automated matches {Bacillus megaterium [TaxId: 1404]}
kyrvrknvlhltdtekrdfvrtvlilkekgiydryiawhgaagkfhtppgsdrnaahmss
aflpwhreyllrferdlqsinpevtlpywewetdaqmqdpsqsqiwsadfmggngnpikd
fivdtgpfaagrwttideqgnpsgglkrnfgatkeaptlptrddvlnalkitqydtppwd
mtsqnsfrnqlegfingpqlhnrvhhwvggqmgvvptapndpvfflhhanvdriwavwqi
ihrnqnyqpmkngpfgqnfrdpmypwnttpedvmnhrklgyvydi

SCOPe Domain Coordinates for d3nq5a_:

Click to download the PDB-style file with coordinates for d3nq5a_.
(The format of our PDB-style files is described here.)

Timeline for d3nq5a_: