SCOPe 2.08: Domain d3nq1a_: 3nq1 A:

Lineage for d3nq1a_ (3nq1 A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.86: Di-copper centre-containing domain [48055] (1 superfamily)
   multihelical

4. Superfamily a.86.1: Di-copper centre-containing domain [48056] (4 families)
   duplication: contains two structural repeats

5. Family a.86.1.0: automated matches [254307] (1 protein)
   not a true family

6. Protein automated matches [254708] (4 species)
   not a true protein

7. Species Bacillus megaterium [TaxId:1404] [255981] (21 PDB entries)

8. Domain d3nq1a_: 3nq1 A: [247996]
   automated match to d2ahka_
   complexed with cu, koj, zn

Details for d3nq1a_

PDB Entry: 3nq1, 2.3 Å

PDB Description: Crystal Structure of Tyrosinase from Bacillus megaterium in complex with inhibitor kojic acid

PDB Compounds: (A:) tyrosinase

SCOPe Domain Sequences for d3nq1a_:

Sequence; same for both SEQRES and ATOM records:

>d3nq1a_ a.86.1.0 (A:) automated matches {Bacillus megaterium [TaxId: 1404]}
kyrvrknvlhltdtekrdfvrtvlilkekgiydryiawhgaagkfhtppgsdrnaahmss
aflpwhreyllrferdlqsinpevtlpywewetdaqmqdpsqsqiwsadfmggngnpikd
fivdtgpfaagrwttideqgnpsgglkrnfgatkeaptlptrddvlnalkitqydtppwd
mtsqnsfrnqlegfingpqlhnrvhrwvggqmgvvptapndpvfflhhanvdriwavwqi
ihrnqnyqpmkngpfgqnfrdpmypwnttpedvmnhrklgyvy

Timeline for d3nq1a_:

• d3nq1a_ first appeared in SCOPe 2.04
  
• d3nq1a_ appears in SCOPe 2.07