Lineage for d3nouc3 (3nou C:310-496)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1665312Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 1665377Superfamily d.110.2: GAF domain-like [55781] (5 families) (S)
    alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654
  5. 1665498Family d.110.2.0: automated matches [191507] (1 protein)
    not a true family
  6. 1665499Protein automated matches [190838] (10 species)
    not a true protein
  7. 1665509Species Pseudomonas aeruginosa [TaxId:208964] [255984] (1 PDB entry)
  8. 1665510Domain d3nouc3: 3nou C:310-496 [247991]
    Other proteins in same PDB: d3nouc1, d3nouc2
    automated match to d3nhqa3
    complexed with bla

Details for d3nouc3

PDB Entry: 3nou (more details), 3 Å

PDB Description: light-induced intermediate structure l3 of p. aeruginosa bacteriophytochrome
PDB Compounds: (C:) Bacteriophytochrome

SCOPe Domain Sequences for d3nouc3:

Sequence, based on SEQRES records: (download)

>d3nouc3 d.110.2.0 (C:310-496) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
riaellrvsterrlalarrardaddlfgalahpddgiaalipcdgalvmlggrtlsirgd
ferqagnvlqrlqrdperdiyhtdnwpqpsedspdggdccgvlairfhrqesgwifwfrh
eevhrirwggkpeklltigpsgprltprgsfeaweevvrghstpwsetdlaiaeklrldl
melclnh

Sequence, based on observed residues (ATOM records): (download)

>d3nouc3 d.110.2.0 (C:310-496) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
riaellrvsterrlalarrardaddlfgalahpddgiaalipcdgalvmlggrtlsirgd
ferqagnvlqrlqrdperdiyhtdnwgdccgvlairfhrqesgwifwfrheevhrirwgg
kpeklltigpsgprltprgsfeaweevvrghstpwsetdlaiaeklrldlmelclnh

SCOPe Domain Coordinates for d3nouc3:

Click to download the PDB-style file with coordinates for d3nouc3.
(The format of our PDB-style files is described here.)

Timeline for d3nouc3: