Lineage for d3no1e2 (3no1 E:148-386)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1573508Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 1573839Family c.1.11.0: automated matches [227196] (1 protein)
    not a true family
  6. 1573840Protein automated matches [226923] (59 species)
    not a true protein
  7. 1574035Species Marine actinobacterium [TaxId:312284] [255974] (3 PDB entries)
  8. 1574046Domain d3no1e2: 3no1 E:148-386 [247986]
    Other proteins in same PDB: d3no1a1, d3no1b1, d3no1c1, d3no1d1, d3no1e1, d3no1f1
    automated match to d3bjsa2
    complexed with mg

Details for d3no1e2

PDB Entry: 3no1 (more details), 2.16 Å

PDB Description: crystal structure of mandelate racemase/muconate lactonizing enzyme from a marine actinobacterium in complex with magnesium
PDB Compounds: (E:) Mandelate racemase/muconate lactonizing enzyme

SCOPe Domain Sequences for d3no1e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3no1e2 c.1.11.0 (E:148-386) automated matches {Marine actinobacterium [TaxId: 312284]}
yrnelpmiaiggyygeplgsiademhnyqelglagvkfkvgglsaaedaaritaareaag
ddfiicidanqgykpavavdlsrriadlnirwfeepvewhndkrsmrdvryqgsvpvcag
qtefsasgcrdlmetgaidvcnfdsswsggptawlrtaaiatsydvqmghheepqvsthl
lasqphgtiaecfhpdrdpfwwnmitnrpklnngtltlsdrpglgwdlnwdyidqyrvs

SCOPe Domain Coordinates for d3no1e2:

Click to download the PDB-style file with coordinates for d3no1e2.
(The format of our PDB-style files is described here.)

Timeline for d3no1e2: