Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) |
Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
Protein automated matches [226922] (88 species) not a true protein |
Species Marine actinobacterium [TaxId:312284] [255973] (3 PDB entries) |
Domain d3no1e1: 3no1 E:19-147 [247985] Other proteins in same PDB: d3no1a2, d3no1b2, d3no1c2, d3no1d2, d3no1e2, d3no1f2 automated match to d3bjsa1 complexed with mg |
PDB Entry: 3no1 (more details), 2.16 Å
SCOPe Domain Sequences for d3no1e1:
Sequence, based on SEQRES records: (download)
>d3no1e1 d.54.1.0 (E:19-147) automated matches {Marine actinobacterium [TaxId: 312284]} gltitrietipmvaplarefrgshyhmthrativtrvhtdagiigeaytgdehetmfdid riiheelaptligqdamaierlwdsgykvtfdilrdrrlglvalaavntaiwdavgkalk mplwklwgg
>d3no1e1 d.54.1.0 (E:19-147) automated matches {Marine actinobacterium [TaxId: 312284]} gltitrietipmvarativtrvhtdagiigeaytgdehetmfdidriiheelaptligqd amaierlwdsgykvtfdilrdrrlglvalaavntaiwdavgkalkmplwklwgg
Timeline for d3no1e1: