SCOPe 2.08: Domain d3no1d2: 3no1 D:148-384

Lineage for d3no1d2 (3no1 D:148-384)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.0: automated matches [227196] (1 protein)
   not a true family

6. Protein automated matches [226923] (79 species)
   not a true protein

7. Species Marine actinobacterium [TaxId:312284] [255974] (3 PDB entries)

8. Domain d3no1d2: 3no1 D:148-384 [247984]
   Other proteins in same PDB: d3no1a1, d3no1b1, d3no1c1, d3no1d1, d3no1e1, d3no1f1
   automated match to d3bjsa2
   complexed with mg

Details for d3no1d2

PDB Entry: 3no1, 2.16 Å

PDB Description: crystal structure of mandelate racemase/muconate lactonizing enzyme from a marine actinobacterium in complex with magnesium

PDB Compounds: (D:) Mandelate racemase/muconate lactonizing enzyme

SCOPe Domain Sequences for d3no1d2:

Sequence; same for both SEQRES and ATOM records:

>d3no1d2 c.1.11.0 (D:148-384) automated matches {Marine actinobacterium [TaxId: 312284]}
yrnelpmiaiggyygeplgsiademhnyqelglagvkfkvgglsaaedaaritaareaag
ddfiicidanqgykpavavdlsrriadlnirwfeepvewhndkrsmrdvryqgsvpvcag
qtefsasgcrdlmetgaidvcnfdsswsggptawlrtaaiatsydvqmghheepqvsthl
lasqphgtiaecfhpdrdpfwwnmitnrpklnngtltlsdrpglgwdlnwdyidqyr

Timeline for d3no1d2:

• d3no1d2 first appeared in SCOPe 2.04
  
• d3no1d2 appears in SCOPe 2.07