Lineage for d3no1b1 (3no1 B:20-147)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947581Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2947582Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2947878Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2947879Protein automated matches [226922] (95 species)
    not a true protein
  7. 2948305Species Marine actinobacterium [TaxId:312284] [255973] (3 PDB entries)
  8. 2948313Domain d3no1b1: 3no1 B:20-147 [247979]
    Other proteins in same PDB: d3no1a2, d3no1b2, d3no1c2, d3no1d2, d3no1e2, d3no1f2
    automated match to d3bjsa1
    complexed with mg

Details for d3no1b1

PDB Entry: 3no1 (more details), 2.16 Å

PDB Description: crystal structure of mandelate racemase/muconate lactonizing enzyme from a marine actinobacterium in complex with magnesium
PDB Compounds: (B:) Mandelate racemase/muconate lactonizing enzyme

SCOPe Domain Sequences for d3no1b1:

Sequence, based on SEQRES records: (download)

>d3no1b1 d.54.1.0 (B:20-147) automated matches {Marine actinobacterium [TaxId: 312284]}
ltitrietipmvaplarefrgshyhmthrativtrvhtdagiigeaytgdehetmfdidr
iiheelaptligqdamaierlwdsgykvtfdilrdrrlglvalaavntaiwdavgkalkm
plwklwgg

Sequence, based on observed residues (ATOM records): (download)

>d3no1b1 d.54.1.0 (B:20-147) automated matches {Marine actinobacterium [TaxId: 312284]}
ltitrietipmvarativtrvhtdagiigeaytgdehetmfdidriiheelaptligqda
maierlwdsgykvtfdilrdrrlglvalaavntaiwdavgkalkmplwklwgg

SCOPe Domain Coordinates for d3no1b1:

Click to download the PDB-style file with coordinates for d3no1b1.
(The format of our PDB-style files is described here.)

Timeline for d3no1b1: