Lineage for d3nndb_ (3nnd B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2143708Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 2143709Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 2143989Family c.93.1.0: automated matches [191439] (1 protein)
    not a true family
  6. 2143990Protein automated matches [190646] (70 species)
    not a true protein
  7. 2144213Species Rhodopseudomonas palustris [TaxId:1076] [255983] (3 PDB entries)
  8. 2144217Domain d3nndb_: 3nnd B: [247974]
    Other proteins in same PDB: d3nnda2
    automated match to d4n0qa_

Details for d3nndb_

PDB Entry: 3nnd (more details), 2.8 Å

PDB Description: The crystal structure of ABC transporter from Rhodopseudomonas palustris
PDB Compounds: (B:) Possible substrate binding protein of ABC transporter system

SCOPe Domain Sequences for d3nndb_:

Sequence, based on SEQRES records: (download)

>d3nndb_ c.93.1.0 (B:) automated matches {Rhodopseudomonas palustris [TaxId: 1076]}
dlkialiygktgpleayakqtetglmmgleyatkgtmtldgrkivvitkddqskpdlska
alaeayqddgadiaigtsssaaaladlpvaeenkkilivepavadqitgekwnryifrtg
rnssqdaisnavaigkqgvtiatlaqdyafgrdgvaafkealaktgatlateeyvptttt
dftavgqrlfdalkdkpgkkiiwviwagggdpltklqdmdpkrygielstggnilpalaa
ykrlpgmegatyyyydipknpinewlvtehqkrfnappdfftaggfsaamavvtavqkak
stdtekliaamegmefdtpkgkmvfrkedhqalqsmyhfkvkvdpavawavl

Sequence, based on observed residues (ATOM records): (download)

>d3nndb_ c.93.1.0 (B:) automated matches {Rhodopseudomonas palustris [TaxId: 1076]}
dlkialiygktgpleayakqtetglmmgleyatkgtmtldgrkivvitkddqskpdlska
alaeayqddgadiaigtsssaaaladlpvaeenkkilivepanryifrtgrnssqdaisn
avaigkqgvtiatlaqdyafgrdgvaafkealaktgatlateeyvpttdftavgqrlfda
lkdkpgkiiwviwapltklqdmdkrygielstggnilpalaaygmegatyyyydipknpi
newlvtehqkrfnappdfftaggfsaamavvtavqkakstdtekliaamegmefdtpkgk
mvfrkedhqalqsmyhfkvkvdpavawavl

SCOPe Domain Coordinates for d3nndb_:

Click to download the PDB-style file with coordinates for d3nndb_.
(The format of our PDB-style files is described here.)

Timeline for d3nndb_: