Lineage for d3nn8f_ (3nn8 F:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)
  8. 2744995Domain d3nn8f_: 3nn8 F: [247970]
    Other proteins in same PDB: d3nn8a2, d3nn8c2, d3nn8d2, d3nn8g2
    automated match to d2d7tl_

Details for d3nn8f_

PDB Entry: 3nn8 (more details), 3.1 Å

PDB Description: Crystal structure of engineered antibody fragment based on 3D5
PDB Compounds: (F:) Engineered scFv, light chain

SCOPe Domain Sequences for d3nn8f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nn8f_ b.1.1.1 (F:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
kdivmtqtpsslpvslgdqasiscrssqsivhsngntylewylqkpgqspklliykvsnr
fsgvpdrfsgsgsgtdftlkisrveaedlgiyycfqgslvpptfgagtklelkrgg

SCOPe Domain Coordinates for d3nn8f_:

Click to download the PDB-style file with coordinates for d3nn8f_.
(The format of our PDB-style files is described here.)

Timeline for d3nn8f_: