SCOPe 2.05: Domain d3nn8e_: 3nn8 E:

Lineage for d3nn8e_ (3nn8 E:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (18 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186842] (133 PDB entries)

8. Domain d3nn8e_: 3nn8 E: [247969]
   automated match to d2d7tl_

Details for d3nn8e_

PDB Entry: 3nn8, 3.1 Å

PDB Description: Crystal structure of engineered antibody fragment based on 3D5

PDB Compounds: (E:) Engineered scFv, light chain

SCOPe Domain Sequences for d3nn8e_:

Sequence; same for both SEQRES and ATOM records:

>d3nn8e_ b.1.1.1 (E:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divmtqtpsslpvslgdqasiscrssqsivhsngntylewylqkpgqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgiyycfqgslvpptfgagtklelkrgg

Timeline for d3nn8e_:

• d3nn8e_ first appeared in SCOPe 2.04
  
• d3nn8e_ appears in SCOPe 2.06
  
• d3nn8e_ appears in the current release, SCOPe 2.08