Lineage for d3nn8d1 (3nn8 D:9-121)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2344610Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 protein domains)
  6. 2347168Protein automated matches [190119] (20 species)
    not a true protein
  7. 2347951Species Mouse (Mus musculus) [TaxId:10090] [186842] (160 PDB entries)
  8. 2348175Domain d3nn8d1: 3nn8 D:9-121 [247968]
    Other proteins in same PDB: d3nn8a2, d3nn8c2, d3nn8d2, d3nn8g2
    automated match to d1ktrh_

Details for d3nn8d1

PDB Entry: 3nn8 (more details), 3.1 Å

PDB Description: Crystal structure of engineered antibody fragment based on 3D5
PDB Compounds: (D:) Engineered scFv, heavy chain

SCOPe Domain Sequences for d3nn8d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nn8d1 b.1.1.1 (D:9-121) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
pedvkpgasvkisckasgyslstsgmgvnwvkqspgkglewlahiywdddkrynpslksr
atltvdktsstvylelrsltsedssvyycarrggsshyyamdywgqgttvtvs

SCOPe Domain Coordinates for d3nn8d1:

Click to download the PDB-style file with coordinates for d3nn8d1.
(The format of our PDB-style files is described here.)

Timeline for d3nn8d1: