SCOPe 2.08: Domain d3nn8c1: 3nn8 C:9-122

Lineage for d3nn8c1 (3nn8 C:9-122)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)

8. Domain d3nn8c1: 3nn8 C:9-122 [247967]
   Other proteins in same PDB: d3nn8a2, d3nn8c2, d3nn8d2, d3nn8g2
   automated match to d1ktrh_

Details for d3nn8c1

PDB Entry: 3nn8, 3.1 Å

PDB Description: Crystal structure of engineered antibody fragment based on 3D5

PDB Compounds: (C:) Engineered scFv, heavy chain

SCOPe Domain Sequences for d3nn8c1:

Sequence; same for both SEQRES and ATOM records:

>d3nn8c1 b.1.1.1 (C:9-122) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
pedvkpgasvkisckasgyslstsgmgvnwvkqspgkglewlahiywdddkrynpslksr
atltvdktsstvylelrsltsedssvyycarrggsshyyamdywgqgttvtvss

Timeline for d3nn8c1:

• d3nn8c1 first appeared in SCOPe 2.04, called d3nn8c_
  
• d3nn8c1 appears in SCOPe 2.07