Lineage for d3nmoa_ (3nmo A:)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2577647Fold f.20: Clc chloride channel [81341] (1 superfamily)
    core: 18 transmembrane helices
  4. 2577648Superfamily f.20.1: Clc chloride channel [81340] (1 family) (S)
  5. 2577649Family f.20.1.1: Clc chloride channel [69912] (2 proteins)
    duplication: consist of two similar structural parts
  6. 2577697Protein automated matches [226846] (3 species)
    not a true protein
  7. 2577727Species Escherichia coli [TaxId:216592] [255982] (2 PDB entries)
  8. 2577728Domain d3nmoa_: 3nmo A: [247964]
    automated match to d1kpla_
    complexed with cl

Details for d3nmoa_

PDB Entry: 3nmo (more details), 3.1 Å

PDB Description: Crystal structure of an engineered monomeric CLC-ec1 Cl-/H+ transporter
PDB Compounds: (A:) H(+)/Cl(-) exchange transporter clcA

SCOPe Domain Sequences for d3nmoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nmoa_ f.20.1.1 (A:) automated matches {Escherichia coli [TaxId: 216592]}
irqllerdktplailfmaavvgtlvglaavafdkgvawlqnqrmgalvhtadnypllltv
aflcsavlamfgyflvrkyapeaggsgipeiegaledqrpvrwwrvlpvkffgglgtlgg
gmvlgregptvqiggnigrmvldifrlkgdearhtllatgaaaglaaafnaplagilfiw
eemrpqfrytlisikavfigvimstimyrifnhevalidvgklsdaplntlwlylilgii
fgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigglcgllgfvapatsgggfnlip
iatagnfsmgmlvfifvarvittllcfssgapggifapmlalgtvlgtafgmvavelfpq
yhleagtfaiagmgallaasirapltgiilvlemtdnyqlwlpmiitglgatllaqftgg
kplysailartlakqeaeq

SCOPe Domain Coordinates for d3nmoa_:

Click to download the PDB-style file with coordinates for d3nmoa_.
(The format of our PDB-style files is described here.)

Timeline for d3nmoa_: