Lineage for d1b34a_ (1b34 A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 13541Fold b.38: Sm motif of small nuclear ribonucleoproteins, SNRNP [50181] (1 superfamily)
  4. 13542Superfamily b.38.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50182] (1 family) (S)
  5. 13543Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (4 proteins)
  6. 13552Protein D1 core SNRNP protein [50184] (1 species)
  7. 13553Species Human (Homo sapiens) [TaxId:9606] [50185] (1 PDB entry)
  8. 13554Domain d1b34a_: 1b34 A: [24796]
    Other proteins in same PDB: d1b34b_

Details for d1b34a_

PDB Entry: 1b34 (more details), 2.5 Å

PDB Description: crystal structure of the d1d2 sub-complex from the human snrnp core domain
PDB Compounds: (A:)

SCOP Domain Sequences for d1b34a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b34a_ b.38.1.1 (A:) D1 core SNRNP protein {Human (Homo sapiens)}
klvrflmklshetvtielkngtqvhgtitgvdvsmnthlkavkmtlknrepvqletlsir
gnniryfilpdslpldtllv

SCOP Domain Coordinates for d1b34a_:

Click to download the PDB-style file with coordinates for d1b34a_.
(The format of our PDB-style files is described here.)

Timeline for d1b34a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1b34b_