Lineage for d3njxa3 (3njx A:338-508)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774100Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2774101Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2774875Family b.18.1.25: Rhamnogalacturonase B, RhgB, C-terminal domain [110128] (1 protein)
  6. 2774876Protein Rhamnogalacturonase B, RhgB, C-terminal domain [110129] (1 species)
  7. 2774877Species Fungus (Aspergillus aculeatus) [TaxId:5053] [110130] (3 PDB entries)
    Uniprot Q00019
  8. 2774878Domain d3njxa3: 3njx A:338-508 [247953]
    Other proteins in same PDB: d3njxa1, d3njxa2
    automated match to d1nkga2
    complexed with ca, so4; mutant

Details for d3njxa3

PDB Entry: 3njx (more details), 1.94 Å

PDB Description: Rhamnogalacturonan Lyase from Aspergillus aculeatus mutant H210A
PDB Compounds: (A:) Rhamnogalacturonase B

SCOPe Domain Sequences for d3njxa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3njxa3 b.18.1.25 (A:338-508) Rhamnogalacturonase B, RhgB, C-terminal domain {Fungus (Aspergillus aculeatus) [TaxId: 5053]}
tgttifkigewdgqptgfrnaanqlrmhpsdsrmsswgpltytvgssaltdfpmavfksv
nnpvtikftatsaqtgaatlrigttlsfaggrpqatinsytgsapaaptnldsrgvtrga
yrglgevydvsipsgtivagtntitinvisgssgdtylspnfifdcvelfq

SCOPe Domain Coordinates for d3njxa3:

Click to download the PDB-style file with coordinates for d3njxa3.
(The format of our PDB-style files is described here.)

Timeline for d3njxa3: