Class b: All beta proteins [48724] (180 folds) |
Fold b.3: Prealbumin-like [49451] (8 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.1: Starch-binding domain-like [49452] (4 families) |
Family b.3.1.2: Rhamnogalacturonase B, RhgB, middle domain [110091] (1 protein) |
Protein Rhamnogalacturonase B, RhgB, middle domain [110092] (1 species) |
Species Fungus (Aspergillus aculeatus) [TaxId:5053] [110093] (3 PDB entries) Uniprot Q00019 |
Domain d3njxa2: 3njx A:251-337 [247952] Other proteins in same PDB: d3njxa1, d3njxa3 automated match to d1nkga1 complexed with ca, so4; mutant |
PDB Entry: 3njx (more details), 1.94 Å
SCOPe Domain Sequences for d3njxa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3njxa2 b.3.1.2 (A:251-337) Rhamnogalacturonase B, RhgB, middle domain {Fungus (Aspergillus aculeatus) [TaxId: 5053]} yvaasgrgkvagtasgadssmdwvvhwyndaaqywtytsssgsftspamkpgtytmvyyq geyavatssvtvsagstttknisgsvk
Timeline for d3njxa2: