Lineage for d3njxa2 (3njx A:251-337)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2768597Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2768598Superfamily b.3.1: Starch-binding domain-like [49452] (4 families) (S)
  5. 2768711Family b.3.1.2: Rhamnogalacturonase B, RhgB, middle domain [110091] (1 protein)
  6. 2768712Protein Rhamnogalacturonase B, RhgB, middle domain [110092] (1 species)
  7. 2768713Species Fungus (Aspergillus aculeatus) [TaxId:5053] [110093] (3 PDB entries)
    Uniprot Q00019
  8. 2768714Domain d3njxa2: 3njx A:251-337 [247952]
    Other proteins in same PDB: d3njxa1, d3njxa3
    automated match to d1nkga1
    complexed with ca, so4; mutant

Details for d3njxa2

PDB Entry: 3njx (more details), 1.94 Å

PDB Description: Rhamnogalacturonan Lyase from Aspergillus aculeatus mutant H210A
PDB Compounds: (A:) Rhamnogalacturonase B

SCOPe Domain Sequences for d3njxa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3njxa2 b.3.1.2 (A:251-337) Rhamnogalacturonase B, RhgB, middle domain {Fungus (Aspergillus aculeatus) [TaxId: 5053]}
yvaasgrgkvagtasgadssmdwvvhwyndaaqywtytsssgsftspamkpgtytmvyyq
geyavatssvtvsagstttknisgsvk

SCOPe Domain Coordinates for d3njxa2:

Click to download the PDB-style file with coordinates for d3njxa2.
(The format of our PDB-style files is described here.)

Timeline for d3njxa2: