Lineage for d3njva3 (3njv A:338-508)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2369590Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2369591Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2370337Family b.18.1.25: Rhamnogalacturonase B, RhgB, C-terminal domain [110128] (1 protein)
  6. 2370338Protein Rhamnogalacturonase B, RhgB, C-terminal domain [110129] (1 species)
  7. 2370339Species Fungus (Aspergillus aculeatus) [TaxId:5053] [110130] (3 PDB entries)
    Uniprot Q00019
  8. 2370342Domain d3njva3: 3njv A:338-508 [247950]
    Other proteins in same PDB: d3njva1, d3njva2
    automated match to d1nkga2
    complexed with ca, gtr, ram, so4

Details for d3njva3

PDB Entry: 3njv (more details), 2.4 Å

PDB Description: rhamnogalacturonan lyase from aspergillus aculeatus k150a substrate complex
PDB Compounds: (A:) Rhamnogalacturonase B

SCOPe Domain Sequences for d3njva3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3njva3 b.18.1.25 (A:338-508) Rhamnogalacturonase B, RhgB, C-terminal domain {Fungus (Aspergillus aculeatus) [TaxId: 5053]}
tgttifkigewdgqptgfrnaanqlrmhpsdsrmsswgpltytvgssaltdfpmavfksv
nnpvtikftatsaqtgaatlrigttlsfaggrpqatinsytgsapaaptnldsrgvtrga
yrglgevydvsipsgtivagtntitinvisgssgdtylspnfifdcvelfq

SCOPe Domain Coordinates for d3njva3:

Click to download the PDB-style file with coordinates for d3njva3.
(The format of our PDB-style files is described here.)

Timeline for d3njva3: