Lineage for d1fgpa_ (1fgp A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2049014Fold b.37: N-terminal domains of the minor coat protein g3p [50175] (1 superfamily)
    core: barrel, in some members open; n*=4, S*=8; meander
  4. 2049015Superfamily b.37.1: N-terminal domains of the minor coat protein g3p [50176] (2 families) (S)
  5. 2049016Family b.37.1.1: N-terminal domains of the minor coat protein g3p [50177] (2 protein domains)
  6. 2049017Protein N-terminal domains of the minor coat protein g3p [50178] (2 species)
    duplication: the two domains share a common fold
  7. 2049018Species Bacteriophage fd [TaxId:10864] [50180] (2 PDB entries)
  8. 2049023Domain d1fgpa_: 1fgp A: [24795]
    CASP2

Details for d1fgpa_

PDB Entry: 1fgp (more details)

PDB Description: membrane penetration domain of the minor coat protein g3p of phage fd, nmr, 15 structures
PDB Compounds: (A:) fd gene 3 protein

SCOPe Domain Sequences for d1fgpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fgpa_ b.37.1.1 (A:) N-terminal domains of the minor coat protein g3p {Bacteriophage fd [TaxId: 10864]}
etvesclakphtensftnvwkddktldryanyegclwnatgvvvctgdetqcygtwvpig
laipenaaah

SCOPe Domain Coordinates for d1fgpa_:

Click to download the PDB-style file with coordinates for d1fgpa_.
(The format of our PDB-style files is described here.)

Timeline for d1fgpa_: