SCOPe 2.05: Domain d3njeb_: 3nje B:

Lineage for d3njeb_ (3nje B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.24: Pili subunits [54522] (1 superfamily)
   contains very long N-terminal helix, which end is packed against beta-sheet

4. Superfamily d.24.1: Pili subunits [54523] (8 families)
   bacterial filament proteins

5. Family d.24.1.0: automated matches [233575] (1 protein)
   not a true family

6. Protein automated matches [233576] (2 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:287] [255339] (2 PDB entries)

8. Domain d3njeb_: 3nje B: [247947]
   automated match to d3ci0j1

Details for d3njeb_

PDB Entry: 3nje, 1.85 Å

PDB Description: structure of the minor pseudopilin xcpw from the pseudomonas aeruginosa type ii secretion system

PDB Compounds: (B:) General secretion pathway protein J

SCOPe Domain Sequences for d3njeb_:

Sequence; same for both SEQRES and ATOM records:

>d3njeb_ d.24.1.0 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
qeqrmrelvramgalerdltqaverpvrdelgdnrgaflsegendqiveftrggwrnplg
qarsrlqrvrwslsgetlerrywlvldraqdskprvqqvldgvtalswrfldkehnwqgh
wptdegseeerleslplavemtlehrhygklvrvwrlldpplkq

Timeline for d3njeb_:

• d3njeb_ first appeared in SCOPe 2.04
  
• d3njeb_ appears in SCOPe 2.06
  
• d3njeb_ appears in the current release, SCOPe 2.08