Lineage for d3nj5a_ (3nj5 A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2061457Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2061458Superfamily b.42.1: Cytokine [50353] (3 families) (S)
  5. 2061865Family b.42.1.0: automated matches [191477] (1 protein)
    not a true family
  6. 2061866Protein automated matches [190764] (2 species)
    not a true protein
  7. 2061867Species Chicken (Gallus gallus) [TaxId:9031] [255980] (6 PDB entries)
  8. 2061869Domain d3nj5a_: 3nj5 A: [247945]
    automated match to d8i1ba_
    mutant

Details for d3nj5a_

PDB Entry: 3nj5 (more details), 1.67 Å

PDB Description: crystal structure of chicken il-1 hydrophobic cavity mutant 157
PDB Compounds: (A:) IL-1 beta

SCOPe Domain Sequences for d3nj5a_:

Sequence, based on SEQRES records: (download)

>d3nj5a_ b.42.1.0 (A:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
afrytrsqsfdifdinqkcfvlesptqlvalhlqgpsssqkvrlnialyrprgprgsagt
gqmpvalgikgyklymscvmsgteptlqleeadvmrdidsveltrfifyrldsptegttr
fesaafpgwfictslqprqpvgitnqpdqvniatfklsg

Sequence, based on observed residues (ATOM records): (download)

>d3nj5a_ b.42.1.0 (A:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
afrytrsqsfdifdinqkcfvlesptqlvalhlqgpsssqkvrlnialyrprgpqmpval
gikgyklymscvmsgteptlqleeadvmrdidsveltrfifyrldsptegttrfesaafp
gwfictslqprqpvgitnqpdqvniatfklsg

SCOPe Domain Coordinates for d3nj5a_:

Click to download the PDB-style file with coordinates for d3nj5a_.
(The format of our PDB-style files is described here.)

Timeline for d3nj5a_: