Lineage for d3niqb_ (3niq B:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1599042Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456
  4. 1599043Superfamily c.42.1: Arginase/deacetylase [52768] (3 families) (S)
  5. 1599399Family c.42.1.0: automated matches [191435] (1 protein)
    not a true family
  6. 1599400Protein automated matches [190626] (6 species)
    not a true protein
  7. 1599403Species Pseudomonas aeruginosa [TaxId:208964] [189976] (3 PDB entries)
  8. 1599405Domain d3niqb_: 3niq B: [247944]
    automated match to d1gq6a_
    complexed with gol, mn

Details for d3niqb_

PDB Entry: 3niq (more details), 2.07 Å

PDB Description: Crystal structure of Pseudomonas aeruginosa guanidinopropionase
PDB Compounds: (B:) 3-guanidinopropionase

SCOPe Domain Sequences for d3niqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3niqb_ c.42.1.0 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
dhpqpldaaeiprfagiptfmrlpaftdpaalqvgligvpwdggttnragarhgprevrn
lsslmrkvhhvsriapydlvrvgdlgdapvnpidlldslrriegfyrqvhaagtlplsvg
gdhlvtlpifralgrerplgmvhfdahsdtndryfgdnpythgtpfrraieeglldplrt
vqigirgsvyspdddafarecgirvihmeefvelgveatlaearrvvgagptyvsfdvdv
ldpafapgtgtpeiggmtslqaqqlvrglrgldlvgadvvevsppfdvggatalvgatmm
fellcllaesaar

SCOPe Domain Coordinates for d3niqb_:

Click to download the PDB-style file with coordinates for d3niqb_.
(The format of our PDB-style files is described here.)

Timeline for d3niqb_: