SCOPe 2.07: Domain d3niqa_: 3niq A:

Lineage for d3niqa_ (3niq A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
   3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456

4. Superfamily c.42.1: Arginase/deacetylase [52768] (3 families)

5. Family c.42.1.0: automated matches [191435] (1 protein)
   not a true family

6. Protein automated matches [190626] (12 species)
   not a true protein

7. Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [189976] (3 PDB entries)

8. Domain d3niqa_: 3niq A: [247943]
   automated match to d1gq6a_
   complexed with gol, mn

Details for d3niqa_

PDB Entry: 3niq, 2.07 Å

PDB Description: Crystal structure of Pseudomonas aeruginosa guanidinopropionase

PDB Compounds: (A:) 3-guanidinopropionase

SCOPe Domain Sequences for d3niqa_:

Sequence; same for both SEQRES and ATOM records:

>d3niqa_ c.42.1.0 (A:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
dhpqpldaaeiprfagiptfmrlpaftdpaalqvgligvpwdggttnragarhgprevrn
lsslmrkvhhvsriapydlvrvgdlgdapvnpidlldslrriegfyrqvhaagtlplsvg
gdhlvtlpifralgrerplgmvhfdahsdtndryfgdnpythgtpfrraieeglldplrt
vqigirgsvyspdddafarecgirvihmeefvelgveatlaearrvvgagptyvsfdvdv
ldpafapgtgtpeiggmtslqaqqlvrglrgldlvgadvvevsppfdvggatalvgatmm
fellcllaesaarsa

Timeline for d3niqa_:

• d3niqa_ first appeared in SCOPe 2.04
  
• d3niqa_ appears in SCOPe 2.06
  
• d3niqa_ appears in the current release, SCOPe 2.08