Lineage for d3nipa_ (3nip A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2115321Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456
  4. 2115322Superfamily c.42.1: Arginase/deacetylase [52768] (3 families) (S)
  5. 2115695Family c.42.1.0: automated matches [191435] (1 protein)
    not a true family
  6. 2115696Protein automated matches [190626] (8 species)
    not a true protein
  7. 2115740Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [189976] (3 PDB entries)
  8. 2115749Domain d3nipa_: 3nip A: [247937]
    automated match to d1gq6a_
    complexed with 16d

Details for d3nipa_

PDB Entry: 3nip (more details), 2.5 Å

PDB Description: Crystal structure of Pseudomonas aeruginosa guanidinopropionase complexed with 1,6-diaminohexane
PDB Compounds: (A:) 3-guanidinopropionase

SCOPe Domain Sequences for d3nipa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nipa_ c.42.1.0 (A:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
ndhpqpldaaeiprfagiptfmrlpaftdpaalqvgligvpwdggttnragarhgprevr
nlsslmrkvhhvsriapydlvrvgdlgdapvnpidlldslrriegfyrqvhaagtlplsv
ggdhlvtlpifralgrerplgmvhfdahsdtndryfgdnpythgtpfrraieeglldplr
tvqigirgsvyspdddafarecgirvihmeefvelgveatlaearrvvgagptyvsfdvd
vldpafapgtgtpeiggmtslqaqqlvrglrgldlvgadvvevsppfdvggatalvgatm
mfellcllaesaarsa

SCOPe Domain Coordinates for d3nipa_:

Click to download the PDB-style file with coordinates for d3nipa_.
(The format of our PDB-style files is described here.)

Timeline for d3nipa_: