Lineage for d3niba1 (3nib A:1-275)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113903Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2113904Protein automated matches [190123] (130 species)
    not a true protein
  7. 2114841Species Uncultured soil [TaxId:164851] [232913] (3 PDB entries)
  8. 2114844Domain d3niba1: 3nib A:1-275 [247936]
    Other proteins in same PDB: d3niba2
    automated match to d3mg9a_
    complexed with gol, nhe

Details for d3niba1

PDB Entry: 3nib (more details), 2.7 Å

PDB Description: Teg14 Apo
PDB Compounds: (A:) Teg14

SCOPe Domain Sequences for d3niba1:

Sequence, based on SEQRES records: (download)

>d3niba1 c.37.1.0 (A:1-275) automated matches {Uncultured soil [TaxId: 164851]}
mngirwiasypkagntwlrcmlaayitgkapqtwkdmetvslelegmlhlgdmppteptk
pvlvkthlkadvpvlglyseatakvlylvrnprdillsamrmtaisrddmessrtfardf
ianeglrmrgrgggaglgswpenvriwtessrdrfpnadvltmryedlkgdpvarfseiv
efldlgdpvdiedirravaactlermrelekrsqqqgqwasmtggrggekhpfvgegryd
qslsflgediesayqellhgdsefahyakqygyag

Sequence, based on observed residues (ATOM records): (download)

>d3niba1 c.37.1.0 (A:1-275) automated matches {Uncultured soil [TaxId: 164851]}
mngirwiasypkagntwlrcmlaayitgkapqtwkdmetvslelegmlhlgdmppteptk
pvlvkthlkadvpvlglyseatakvlylvrnprdillsamrdmessrtfardfianeglr
ggaglgswpenvriwtessrdrfpnadvltmryedlkgdpvarfseivefldlgdpvdie
dirravaactlermrelekrsqqslsflgediesayqellhgdsefahyakqygyag

SCOPe Domain Coordinates for d3niba1:

Click to download the PDB-style file with coordinates for d3niba1.
(The format of our PDB-style files is described here.)

Timeline for d3niba1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3niba2