![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) ![]() consists of one domain of this fold |
![]() | Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (17 proteins) contains Pfam PF00929 |
![]() | Protein automated matches [190162] (6 species) not a true protein |
![]() | Species Escherichia coli [TaxId:562] [187263] (14 PDB entries) |
![]() | Domain d3nh2e_: 3nh2 E: [247931] automated match to d2f96a1 protein/DNA complex; protein/RNA complex |
PDB Entry: 3nh2 (more details), 2.3 Å
SCOPe Domain Sequences for d3nh2e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3nh2e_ c.55.3.5 (E:) automated matches {Escherichia coli [TaxId: 562]} glcdrfrgfypvvidvetagfnaktdalleiaaitlkmdeqgwlmpdttlhfhvepfvga nlqpealafngidpndpdrgavseyealheifkvvrkgikasgcnraimvahnanfdhsf mmaaaeraslkrnpfhpfatfdtaalaglalgqtvlskacqtagmdfdstqahsalydte rtavlfceivnrwkrlggwplsaaee
Timeline for d3nh2e_: