SCOP 1.55: Domain d2g3pb1: 2g3p B:2-67

Lineage for d2g3pb1 (2g3p B:2-67)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.37: N-terminal domains of the minor coat protein g3p [50175] (1 superfamily)

4. Superfamily b.37.1: N-terminal domains of the minor coat protein g3p [50176] (1 family)

5. Family b.37.1.1: N-terminal domains of the minor coat protein g3p [50177] (1 protein)

6. Protein N-terminal domains of the minor coat protein g3p [50178] (2 species)

7. Species Bacteriophage fd [TaxId:10864] [50180] (2 PDB entries)

8. Domain d2g3pb1: 2g3p B:2-67 [24793]

Details for d2g3pb1

PDB Entry: 2g3p, 1.9 Å

PDB Description: structure of the n-terminal two domains of the infectivity protein g3p of filamentous phage fd

SCOP Domain Sequences for d2g3pb1:

Sequence; same for both SEQRES and ATOM records:

>d2g3pb1 b.37.1.1 (B:2-67) N-terminal domains of the minor coat protein g3p {Bacteriophage fd}
etvesclakphtensftnvwkddktldryanyegclwnatgvvvctgdetqcygtwvpig
laipen

Timeline for d2g3pb1:

• d2g3pb1 appears in SCOP 1.57
  
• d2g3pb1 appears in the current release, SCOPe 2.08