Lineage for d3nh2a_ (3nh2 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1857400Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1859086Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 1859666Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (16 proteins)
    contains Pfam PF00929
  6. 1860029Protein automated matches [190162] (5 species)
    not a true protein
  7. 1860040Species Escherichia coli [TaxId:562] [187263] (14 PDB entries)
  8. 1860059Domain d3nh2a_: 3nh2 A: [247929]
    automated match to d2f96a1
    protein/DNA complex; protein/RNA complex

Details for d3nh2a_

PDB Entry: 3nh2 (more details), 2.3 Å

PDB Description: Crystal structure of RNase T in complex with a stem DNA with a 3' overhang
PDB Compounds: (A:) Ribonuclease T

SCOPe Domain Sequences for d3nh2a_:

Sequence, based on SEQRES records: (download)

>d3nh2a_ c.55.3.5 (A:) automated matches {Escherichia coli [TaxId: 562]}
glcdrfrgfypvvidvetagfnaktdalleiaaitlkmdeqgwlmpdttlhfhvepfvga
nlqpealafngidpndpdrgavseyealheifkvvrkgikasgcnraimvahnanfdhsf
mmaaaeraslkrnpfhpfatfdtaalaglalgqtvlskacqtagmdfdstqahsalydte
rtavlfceivnrwkrlggwplsaaeev

Sequence, based on observed residues (ATOM records): (download)

>d3nh2a_ c.55.3.5 (A:) automated matches {Escherichia coli [TaxId: 562]}
glcdrfrgfypvvidvetagfnaktdalleiaaitlkmdeqgwlmpdttlhfhvepfvga
nlqpealafngidpndpdrgavseyealheifkvvrkgikasgcnraimvahnanfdhsf
mmaaaeraslkrnpfhpfatfdtaalaglalgqtvlskacqtagmdfdsalydtertavl
fceivnrwkrlggwplsaaeev

SCOPe Domain Coordinates for d3nh2a_:

Click to download the PDB-style file with coordinates for d3nh2a_.
(The format of our PDB-style files is described here.)

Timeline for d3nh2a_: